PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK32075.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 236aa    MW: 26323.4 Da    PI: 9.0407
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK32075.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++ +G g+W++ ++  g+ R++k+c++rw +yl
       KFK32075.1 14 KGAWTKEEDQRLIDYIRNHGEGCWRSLPKSAGLFRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.47.1e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ eEd+++++++ +lG++ W++Ia +++ gRt++++k++w+++
       KFK32075.1  67 RGNFSDEEDQIIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.845961IPR017930Myb domain
SMARTSM007171.8E-131363IPR001005SANT/Myb domain
SuperFamilySSF466893.95E-2913108IPR009057Homeodomain-like
PfamPF002495.4E-161461IPR001005SANT/Myb domain
CDDcd001671.74E-111661No hitNo description
PROSITE profilePS5129428.3662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2865117IPR009057Homeodomain-like
SMARTSM007175.4E-1766114IPR001005SANT/Myb domain
PfamPF002494.5E-1667111IPR001005SANT/Myb domain
CDDcd001679.51E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIDYIR NHGEGCWRSL PKSAGLFRCG KSCRLRWINY  60
LRPDLKRGNF SDEEDQIIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLISHG  120
IDPQTHRPIN DSKTTPSQSV VVPPQNGAVE YSFAVSPKTE NSSDNGVSTS GTTTDEDLRQ  180
NSDCHYSDNS GHRELNLDLT LGSGSLVRSG RVVGAGSSAE SRPWRDPVTA VRLSLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30141167108B-MYB
1h8a_C2e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288570.11e-148hypothetical protein CARUB_v10001860mg
SwissprotQ388511e-149MYB6_ARATH; Transcription repressor MYB6
TrEMBLA0A087GQC31e-175A0A087GQC3_ARAAL; Uncharacterized protein
STRINGAT4G09460.11e-146(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.11e-150myb domain protein 6